Lineage for d1cjda2 (1cjd A:245-383)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 107845Fold b.13: Nucleoplasmin/PNGase F-like [49741] (3 superfamilies)
  4. 107865Superfamily b.13.2: Viral proteins [49749] (2 families) (S)
  5. 107866Family b.13.2.1: Coat protein p3 [49750] (1 protein)
  6. 107867Protein Coat protein p3 [63403] (1 species)
  7. 107868Species Bacteriophage prd1 [TaxId:10658] [49752] (3 PDB entries)
  8. 107876Domain d1cjda2: 1cjd A:245-383 [58964]

Details for d1cjda2

PDB Entry: 1cjd (more details), 1.85 Å

PDB Description: the bacteriophage prd1 coat protein, p3, is structurally similar to human adenovirus hexon

SCOP Domain Sequences for d1cjda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cjda2 b.13.2.1 (A:245-383) Coat protein p3 {Bacteriophage prd1}
ngyilplidlstlynlensaqagltpnvdfvvqyanlyrylstiavfdnggsfnagtdin
ylsqrtanfsdtrkldpktwaaqtrrriatdfpkgvyycdnrdkpiytlqygnvgfvvnp
ktvnqnarllmgyeyftsr

SCOP Domain Coordinates for d1cjda2:

Click to download the PDB-style file with coordinates for d1cjda2.
(The format of our PDB-style files is described here.)

Timeline for d1cjda2: