Lineage for d1bqba_ (1bqb A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2963595Family d.92.1.2: Thermolysin-like [55490] (5 proteins)
    includes alpha-helical C-terminal domain characteristic for the family
  6. 2963596Protein Aureolysin [63416] (1 species)
  7. 2963597Species Staphylococcus aureus [TaxId:1280] [55498] (1 PDB entry)
  8. 2963598Domain d1bqba_: 1bqb A: [58962]
    complexed with ca, zn

Details for d1bqba_

PDB Entry: 1bqb (more details), 1.72 Å

PDB Description: aureolysin, staphylococcus aureus metalloproteinase
PDB Compounds: (A:) protein (aureolysin)

SCOPe Domain Sequences for d1bqba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bqba_ d.92.1.2 (A:) Aureolysin {Staphylococcus aureus [TaxId: 1280]}
aaatgtgkgvlgdtkdininsidggfsledlthqgklsaynfndqtgqatlitnedenfv
kddqragvdanyyakqtydyykntfgresydnhgspivslthvnhyggqdnrnnaawigd
kmiygdgdgrtftnlsgandvvaheithgvtqqtanleykdqsgalnesfsdvfgyfvdd
edflmgedvytpgkegdalrsmsnpeqfgqpshmkdyvytekdnggvhtnsgipnkaayn
viqaigkskseqiyyralteyltsnsnfkdlkdalyqaakdlyeqqtaeqvyeawnevgv
e

SCOPe Domain Coordinates for d1bqba_:

Click to download the PDB-style file with coordinates for d1bqba_.
(The format of our PDB-style files is described here.)

Timeline for d1bqba_: