SCOP 1.73: Domain d1bgyb2: 1bgy B:236-439

Lineage for d1bgyb2 (1bgy B:236-439)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
   core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta

4. Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families)
   Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues

5. Family d.185.1.1: MPP-like [63412] (6 proteins)
   Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal

6. Protein Cytochrome bc1 core subunit 2 [63409] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [56000] (12 PDB entries)

8. Domain d1bgyb2: 1bgy B:236-439 [58957]
   Other proteins in same PDB: d1bgya1, d1bgya2, d1bgyc2, d1bgyc3, d1bgyd2, d1bgyd3, d1bgye_, d1bgyf_, d1bgyg_, d1bgyh_, d1bgyj_, d1bgyk_, d1bgym1, d1bgym2, d1bgyo2, d1bgyo3, d1bgyp2, d1bgyp3, d1bgyq1, d1bgyq2, d1bgyr_, d1bgys_, d1bgyt_, d1bgyv_, d1bgyw_

Details for d1bgyb2

PDB Entry: 1bgy, 3 Å

PDB Description: cytochrome bc1 complex from bovine

PDB Compounds: (B:) cytochrome bc1 complex

SCOP Domain Sequences for d1bgyb2:

Sequence; same for both SEQRES and ATOM records:

>d1bgyb2 d.185.1.1 (B:236-439) Cytochrome bc1 core subunit 2 {Cow (Bos taurus) [TaxId: 9913]}
kakyhggeireqngdslvhaalvaesaaigsaeanafsvlqhvlgagphvkrgsnatssl
yqavakgvhqpfdvsafnasysdsglfgfytisqaasagdvikaaynqvktiaqgnlsnp
dvqaaknklkagylmsvessegfldevgsqalaagsytppstvlqqidavadadvinaak
kfvsgrksmaasgnlghtpfidel

Timeline for d1bgyb2:

• d1bgyb2 first appeared in SCOP 1.57
  
• d1bgyb2 appears in SCOP 1.71
  
• d1bgyb2 appears in SCOP 1.75
  
• d1bgyb2 appears in the current release, SCOPe 2.08