SCOP 1.73: Domain d1be3a1: 1be3 A:1-233

Lineage for d1be3a1 (1be3 A:1-233)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
   core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta

4. Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families)
   Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues

5. Family d.185.1.1: MPP-like [63412] (6 proteins)
   Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal

6. Protein Cytochrome bc1 core subunit 1 [63408] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [55997] (18 PDB entries)

8. Domain d1be3a1: 1be3 A:1-233 [58950]
   Other proteins in same PDB: d1be3b1, d1be3b2, d1be3c2, d1be3c3, d1be3d2, d1be3d3, d1be3e1, d1be3e2, d1be3f_, d1be3g_, d1be3h_, d1be3j_, d1be3k_

Details for d1be3a1

PDB Entry: 1be3, 3 Å

PDB Description: cytochrome bc1 complex from bovine

PDB Compounds: (A:) cytochrome bc1 complex

SCOP Domain Sequences for d1be3a1:

Sequence; same for both SEQRES and ATOM records:

>d1be3a1 d.185.1.1 (A:1-233) Cytochrome bc1 core subunit 1 {Cow (Bos taurus) [TaxId: 9913]}
tatyaqalqsvpetqvsqldnglrvaseqssqptctvgvwidagsryeseknngagyfve
hlafkgtknrpgnalekevesmgahlnaystrehtayyikalskdlpkavelladivqnc
sledsqiekerdvilqelqendtsmrdvvfnylhatafqgtplaqsvegpsenvrklsra
dlteylsrhykaprmvlaaagglehrqlldlaqkhfsglsgtydedavptlsp

Timeline for d1be3a1:

• d1be3a1 first appeared in SCOP 1.57
  
• d1be3a1 appears in SCOP 1.71
  
• d1be3a1 appears in SCOP 1.75
  
• d1be3a1 appears in the current release, SCOPe 2.08