Lineage for d1bccb2 (1bcc B:236-439)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 265229Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 265230Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 265231Family d.185.1.1: MPP-like [63412] (4 proteins)
    Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal
  6. 265258Protein Cytochrome bc1 core subunit 2 [63409] (3 species)
  7. 265268Species Chicken (Gallus gallus) [TaxId:9031] [56001] (3 PDB entries)
  8. 265270Domain d1bccb2: 1bcc B:236-439 [58949]
    Other proteins in same PDB: d1bcca1, d1bcca2, d1bccc2, d1bccc3, d1bccd2, d1bccd3, d1bcce1, d1bcce2, d1bccf_, d1bccg_, d1bcch_, d1bccj_
    complexed with bog, fes, hem, pee, u10

Details for d1bccb2

PDB Entry: 1bcc (more details), 3.16 Å

PDB Description: cytochrome bc1 complex from chicken

SCOP Domain Sequences for d1bccb2:

Sequence, based on SEQRES records: (download)

>d1bccb2 d.185.1.1 (B:236-439) Cytochrome bc1 core subunit 2 {Chicken (Gallus gallus)}
kakyrggeireqngdslvhaaivaesaaiggaeanafsvlqhvlganphvkrglnatssl
yqavakgvhqpfdvsafnasysdsglfgfytisqaayagqvikaaynqvktiaqgnvsne
nvqaaknklkakylmsvessegfleevgsqalaagsynppstvlqqidavadadvikaak
kfvsrqksmaasgnlghtpfvdel

Sequence, based on observed residues (ATOM records): (download)

>d1bccb2 d.185.1.1 (B:236-439) Cytochrome bc1 core subunit 2 {Chicken (Gallus gallus)}
kakyrggeireqngdslvhaaivaesaaiggaeanafsvlqhvlganphvkrgnpfdvsa
fnasysdsglfgfytisqaayagqvikaaynqvktiaqgnvsnenvqaaknklkakylms
vessegfleevgsqalaagsynppstvlqqidavadadvikaakkfvsrqksmaasgnlg
htpfvdel

SCOP Domain Coordinates for d1bccb2:

Click to download the PDB-style file with coordinates for d1bccb2.
(The format of our PDB-style files is described here.)

Timeline for d1bccb2: