SCOP 1.65: Domain d1bccb1: 1bcc B:18-235

Lineage for d1bccb1 (1bcc B:18-235)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
   core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta

4. Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families)
   Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues

5. Family d.185.1.1: MPP-like [63412] (4 proteins)
   Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal

6. Protein Cytochrome bc1 core subunit 2 [63409] (3 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [56001] (3 PDB entries)

8. Domain d1bccb1: 1bcc B:18-235 [58948]
   Other proteins in same PDB: d1bcca1, d1bcca2, d1bccc2, d1bccc3, d1bccd2, d1bccd3, d1bcce1, d1bcce2, d1bccf_, d1bccg_, d1bcch_, d1bccj_

Details for d1bccb1

PDB Entry: 1bcc, 3.16 Å

PDB Description: cytochrome bc1 complex from chicken

SCOP Domain Sequences for d1bccb1:

Sequence; same for both SEQRES and ATOM records:

>d1bccb1 d.185.1.1 (B:18-235) Cytochrome bc1 core subunit 2 {Chicken (Gallus gallus)}
pphpqdleitklpnglviaslenyspgstigvfikagsryenssnlgtshllrlassltt
kgassfkitrgieavggklsvestrenmaytveclrddveilmefllnvttapefrpwev
adlqpqlkidkavafqnpqthvienlhaaayrnaladslycpdyrigkvtsvelhdfvqn
hftsarmalvglgvshpvlknvaeqllnirgglglsga

Timeline for d1bccb1:

• d1bccb1 first appeared in SCOP 1.57
  
• d1bccb1 appears in SCOP 1.63
  
• d1bccb1 appears in SCOP 1.67
  
• d1bccb1 appears in the current release, SCOPe 2.08