Lineage for d1bcca1 (1bcc A:4-232)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 199430Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
  4. 199431Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families) (S)
  5. 199432Family d.185.1.1: MPP-like [63412] (4 proteins)
  6. 199433Protein Cytochrome bc1 core subunit 1 [63408] (3 species)
  7. 199441Species Chicken (Gallus gallus) [TaxId:9031] [55998] (3 PDB entries)
  8. 199442Domain d1bcca1: 1bcc A:4-232 [58946]
    Other proteins in same PDB: d1bccb1, d1bccb2, d1bccc1, d1bccd2, d1bccd3, d1bcce1, d1bcce2, d1bccf1, d1bccg1, d1bcch1, d1bccj1

Details for d1bcca1

PDB Entry: 1bcc (more details), 3.16 Å

PDB Description: cytochrome bc1 complex from chicken
PDB Compounds: (A:)

SCOP Domain Sequences for d1bcca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bcca1 d.185.1.1 (A:4-232) Cytochrome bc1 core subunit 1 {Chicken (Gallus gallus)}
yaqalqsvpetqvsqldngvrvaseqssqptctvgvwidagsryeseknngagyflehla
fkgtknrpqnalekevesmgahlnayssrehtayyikalskdvpkavelladivqncsle
dsqiekerdvivrelqendtsmrevvfnylhatafqgtglaqsvegpsenirklsradlt
eylsthytaprmvlaaaggvehqqllelaqkhfggvpftydddavptls

SCOP Domain Coordinates for d1bcca1:

Click to download the PDB-style file with coordinates for d1bcca1.
(The format of our PDB-style files is described here.)

Timeline for d1bcca1: