Lineage for d1b9nb3 (1b9n B:127-199)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1787538Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1790106Superfamily b.40.6: MOP-like [50331] (4 families) (S)
  5. 1790153Family b.40.6.2: BiMOP, duplicated molybdate-binding domain [50335] (2 proteins)
    duplication: tandem repeat of two OB-fold domains with swapped C-terminal strands
    automatically mapped to Pfam PF03459
  6. 1790154Protein C-terminal domain of molybdate-dependent transcriptional regulator ModE [63405] (1 species)
  7. 1790155Species Escherichia coli [TaxId:562] [50337] (5 PDB entries)
  8. 1790170Domain d1b9nb3: 1b9n B:127-199 [58944]
    Other proteins in same PDB: d1b9na1, d1b9nb1
    complexed with ni

Details for d1b9nb3

PDB Entry: 1b9n (more details), 2.09 Å

PDB Description: regulator from escherichia coli
PDB Compounds: (B:) protein (mode)

SCOPe Domain Sequences for d1b9nb3:

Sequence, based on SEQRES records: (download)

>d1b9nb3 b.40.6.2 (B:127-199) C-terminal domain of molybdate-dependent transcriptional regulator ModE {Escherichia coli [TaxId: 562]}
arnqwfgtitardhddvqqhvdvlladgktrlkvaitaqsgarlgldegkevlillkapw
vgitqdeavaqna

Sequence, based on observed residues (ATOM records): (download)

>d1b9nb3 b.40.6.2 (B:127-199) C-terminal domain of molybdate-dependent transcriptional regulator ModE {Escherichia coli [TaxId: 562]}
arnqwfgtitaqhvdvlladgktrlkvaitaqsgarlgldegkevlillkapwvgitqde
avaqna

SCOPe Domain Coordinates for d1b9nb3:

Click to download the PDB-style file with coordinates for d1b9nb3.
(The format of our PDB-style files is described here.)

Timeline for d1b9nb3: