SCOPe 2.06: Domain d1b9mb4: 1b9m B:200-262

Lineage for d1b9mb4 (1b9m B:200-262)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.6: MOP-like [50331] (4 families)

5. Family b.40.6.2: BiMOP, duplicated molybdate-binding domain [50335] (2 proteins)
   duplication: tandem repeat of two OB-fold domains with swapped C-terminal strands
   automatically mapped to Pfam PF03459

6. Protein C-terminal domain of molybdate-dependent transcriptional regulator ModE [63405] (1 species)

7. Species Escherichia coli [TaxId:562] [50337] (5 PDB entries)

8. Domain d1b9mb4: 1b9m B:200-262 [58941]
   Other proteins in same PDB: d1b9ma1, d1b9mb1
   complexed with ni

Details for d1b9mb4

PDB Entry: 1b9m, 1.75 Å

PDB Description: regulator from escherichia coli

PDB Compounds: (B:) protein (mode)

SCOPe Domain Sequences for d1b9mb4:

Sequence; same for both SEQRES and ATOM records:

>d1b9mb4 b.40.6.2 (B:200-262) C-terminal domain of molybdate-dependent transcriptional regulator ModE {Escherichia coli [TaxId: 562]}
dnqlpgiishiergaeqcevlmalpdgqtlcatvpvneatslqqgqnvtayfnadsviia
tlc

Timeline for d1b9mb4:

• d1b9mb4 first appeared in SCOP 1.57
  
• d1b9mb4 appears in SCOPe 2.05
  
• d1b9mb4 appears in SCOPe 2.07
  
• d1b9mb4 appears in the current release, SCOPe 2.08