Lineage for d1b9mb4 (1b9m B:200-262)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2790988Superfamily b.40.6: MOP-like [50331] (4 families) (S)
  5. 2791035Family b.40.6.2: BiMOP, duplicated molybdate-binding domain [50335] (2 proteins)
    duplication: tandem repeat of two OB-fold domains with swapped C-terminal strands
    automatically mapped to Pfam PF03459
  6. 2791036Protein C-terminal domain of molybdate-dependent transcriptional regulator ModE [63405] (1 species)
  7. 2791037Species Escherichia coli [TaxId:562] [50337] (5 PDB entries)
  8. 2791049Domain d1b9mb4: 1b9m B:200-262 [58941]
    Other proteins in same PDB: d1b9ma1, d1b9mb1
    complexed with ni

Details for d1b9mb4

PDB Entry: 1b9m (more details), 1.75 Å

PDB Description: regulator from escherichia coli
PDB Compounds: (B:) protein (mode)

SCOPe Domain Sequences for d1b9mb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b9mb4 b.40.6.2 (B:200-262) C-terminal domain of molybdate-dependent transcriptional regulator ModE {Escherichia coli [TaxId: 562]}
dnqlpgiishiergaeqcevlmalpdgqtlcatvpvneatslqqgqnvtayfnadsviia
tlc

SCOPe Domain Coordinates for d1b9mb4:

Click to download the PDB-style file with coordinates for d1b9mb4.
(The format of our PDB-style files is described here.)

Timeline for d1b9mb4: