Lineage for d1b9ma3 (1b9m A:127-199)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. Superfamily b.40.6: MOP-like [50331] (4 families) (S)
  5. Family b.40.6.2: BiMOP, duplicated molybdate-binding domain [50335] (2 proteins)
    duplication: tandem repeat of two OB-fold domains with swapped C-terminal strands
    automatically mapped to Pfam PF03459
  6. Protein C-terminal domain of molybdate-dependent transcriptional regulator ModE [63405] (1 species)
  7. Species Escherichia coli [TaxId:562] [50337] (5 PDB entries)
  8. Domain d1b9ma3: 1b9m A:127-199 [58938]
    Other proteins in same PDB: d1b9ma1, d1b9mb1
    complexed with ni

Details for d1b9ma3

PDB Entry: 1b9m (more details), 1.7500000000000002 Å

PDB Description: regulator from escherichia coli
PDB Compounds: (A:) protein (mode)

SCOPe Domain Sequences for d1b9ma3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b9ma3 b.40.6.2 (A:127-199) C-terminal domain of molybdate-dependent transcriptional regulator ModE {Escherichia coli [TaxId: 562]}
arnqwfgtitardhddvqqhvdvlladgktrlkvaitaqsgarlgldegkevlillkapw
vgitqdeavaqna

SCOPe Domain Coordinates for d1b9ma3 are not available.

Timeline for d1b9ma3:

Domains from same chain:
(mouse over for more information)
d1b9ma1, d1b9ma4
Domains from other chains:
(mouse over for more information)
d1b9mb1, d1b9mb3, d1b9mb4