Lineage for d1aiph2 (1aip H:54-196)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503015Fold d.43: Elongation factor Ts (EF-Ts), dimerisation domain [54712] (1 superfamily)
    beta(2)-alpha(n)-beta; 2 layers a/b; antiparallel sheet: 123
  4. 503016Superfamily d.43.1: Elongation factor Ts (EF-Ts), dimerisation domain [54713] (1 family) (S)
  5. 503017Family d.43.1.1: Elongation factor Ts (EF-Ts), dimerisation domain [54714] (1 protein)
  6. 503018Protein Elongation factor Ts (EF-Ts), dimerisation domain [63422] (2 species)
  7. 503024Species Thermus thermophilus [TaxId:274] [54717] (2 PDB entries)
  8. 503029Domain d1aiph2: 1aip H:54-196 [58937]
    Other proteins in same PDB: d1aipa1, d1aipa2, d1aipa3, d1aipb1, d1aipb2, d1aipb3, d1aipc1, d1aipd1, d1aipe1, d1aipe2, d1aipe3, d1aipf1, d1aipf2, d1aipf3, d1aipg1, d1aiph1

Details for d1aiph2

PDB Entry: 1aip (more details), 3 Å

PDB Description: ef-tu ef-ts complex from thermus thermophilus

SCOP Domain Sequences for d1aiph2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aiph2 d.43.1.1 (H:54-196) Elongation factor Ts (EF-Ts), dimerisation domain {Thermus thermophilus}
earegiighyihhnqrvgvlvelncetdfvarnelfqnlakdlamhiammnpryvsaeei
paeelekerqiyiqaalnegkpqqiaekiaegrlkkyleevvlleqpfvkddkvkvkeli
qqaiakigenivvrrfcrfelga

SCOP Domain Coordinates for d1aiph2:

Click to download the PDB-style file with coordinates for d1aiph2.
(The format of our PDB-style files is described here.)

Timeline for d1aiph2: