Lineage for d1aipg1 (1aip G:2-53)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696009Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 2696033Superfamily a.5.2: UBA-like [46934] (5 families) (S)
  5. 2696177Family a.5.2.2: TS-N domain [63423] (1 protein)
  6. 2696178Protein Elongation factor Ts (EF-Ts), N-terminal domain [63424] (4 species)
  7. 2696196Species Thermus thermophilus [TaxId:274] [63426] (1 PDB entry)
  8. 2696199Domain d1aipg1: 1aip G:2-53 [58934]
    Other proteins in same PDB: d1aipa1, d1aipa2, d1aipa3, d1aipb1, d1aipb2, d1aipb3, d1aipc2, d1aipd2, d1aipe1, d1aipe2, d1aipe3, d1aipf1, d1aipf2, d1aipf3, d1aipg2, d1aiph2

Details for d1aipg1

PDB Entry: 1aip (more details), 3 Å

PDB Description: ef-tu ef-ts complex from thermus thermophilus
PDB Compounds: (G:) elongation factor ts

SCOPe Domain Sequences for d1aipg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aipg1 a.5.2.2 (G:2-53) Elongation factor Ts (EF-Ts), N-terminal domain {Thermus thermophilus [TaxId: 274]}
sqmelikklreatgagmmdvkraledagwdeekavqllrergamkaakkadr

SCOPe Domain Coordinates for d1aipg1:

Click to download the PDB-style file with coordinates for d1aipg1.
(The format of our PDB-style files is described here.)

Timeline for d1aipg1: