SCOP 1.61: Domain d1aipc1: 1aip C:2-53

Lineage for d1aipc1 (1aip C:2-53)

1. Root: SCOP 1.61

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.5: RuvA C-terminal domain-like [46928] (6 superfamilies)

4. Superfamily a.5.2: UBA-like [46934] (3 families)

5. Family a.5.2.2: TS-N domain [63423] (1 protein)

6. Protein Elongation factor Ts (EF-Ts), N-terminal domain [63424] (2 species)

7. Species Thermus thermophilus [TaxId:274] [63426] (1 PDB entry)

8. Domain d1aipc1: 1aip C:2-53 [58930]
   Other proteins in same PDB: d1aipa1, d1aipa2, d1aipa3, d1aipb1, d1aipb2, d1aipb3, d1aipc2, d1aipd2, d1aipe1, d1aipe2, d1aipe3, d1aipf1, d1aipf2, d1aipf3, d1aipg2, d1aiph2

Details for d1aipc1

PDB Entry: 1aip, 3 Å

PDB Description: ef-tu ef-ts complex from thermus thermophilus

SCOP Domain Sequences for d1aipc1:

Sequence; same for both SEQRES and ATOM records:

>d1aipc1 a.5.2.2 (C:2-53) Elongation factor Ts (EF-Ts), N-terminal domain {Thermus thermophilus}
sqmelikklreatgagmmdvkraledagwdeekavqllrergamkaakkadr

Timeline for d1aipc1:

• d1aipc1 first appeared in SCOP 1.57
  
• d1aipc1 appears in SCOP 1.59
  
• d1aipc1 appears in SCOP 1.63
  
• d1aipc1 appears in the current release, SCOPe 2.08