Lineage for d1abza_ (1abz A:)

  1. Root: SCOP 1.73
  2. 757717Class k: Designed proteins [58788] (44 folds)
  3. 758008Fold k.15: helix-turn-helix motif [58877] (1 superfamily)
  4. 758009Superfamily k.15.1: helix-turn-helix motif [58878] (1 family) (S)
  5. 758010Family k.15.1.1: helix-turn-helix motif [58879] (2 proteins)
  6. 758011Protein Alpha-t-alpha, a de novo designed peptide [58880] (1 species)
  7. 758012Species Synthetic non-biological sequence [58881] (1 PDB entry)
  8. 758013Domain d1abza_: 1abz A: [46442]

Details for d1abza_

PDB Entry: 1abz (more details)

PDB Description: alpha-t-alpha, a de novo designed peptide, nmr, 23 structures
PDB Compounds: (A:) alpha-t-alpha

SCOP Domain Sequences for d1abza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1abza_ k.15.1.1 (A:) Alpha-t-alpha, a de novo designed peptide {Synthetic non-biological sequence}
xdwlkarveqelqaleargtdsnaelrameaklkaeiqk

SCOP Domain Coordinates for d1abza_:

Click to download the PDB-style file with coordinates for d1abza_.
(The format of our PDB-style files is described here.)

Timeline for d1abza_: