Lineage for d1meyf_ (1mey F:)

  1. Root: SCOP 1.75
  2. 900990Class k: Designed proteins [58788] (44 folds)
  3. 901215Fold k.12: Zinc finger design [58856] (1 superfamily)
  4. 901216Superfamily k.12.1: Zinc finger design [58857] (1 family) (S)
  5. 901217Family k.12.1.1: Zinc finger design [58858] (7 proteins)
  6. 901222Protein Designed zinc finger protein [58859] (3 species)
  7. 901313Species Synthetic consensus sequence, non-biological source [58860] (1 PDB entry)
  8. 901315Domain d1meyf_: 1mey F: [46431]

Details for d1meyf_

PDB Entry: 1mey (more details), 2.2 Å

PDB Description: crystal structure of a designed zinc finger protein bound to dna
PDB Compounds: (F:) consensus zinc finger

SCOP Domain Sequences for d1meyf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1meyf_ k.12.1.1 (F:) Designed zinc finger protein {Synthetic consensus sequence, non-biological source}
mekpykcpecgksfsqssnlqkhqrthtgekpykcpecgksfsqssdlqkhqrthtgekp
ykcpecgksfsrsdhlsrhqrthq

SCOP Domain Coordinates for d1meyf_:

Click to download the PDB-style file with coordinates for d1meyf_.
(The format of our PDB-style files is described here.)

Timeline for d1meyf_: