SCOP 1.71: Domain d1meyc_: 1mey C:

Lineage for d1meyc_ (1mey C:)

1. Root: SCOP 1.71

2. Class k: Designed proteins [58788] (42 folds)

3. Fold k.12: Zinc finger design [58856] (1 superfamily)

4. Superfamily k.12.1: Zinc finger design [58857] (1 family)

5. Family k.12.1.1: Zinc finger design [58858] (5 proteins)

6. Protein Designed zinc finger protein [58859] (1 species)

7. Species Synthetic consensus sequence, non-biological source [58860] (1 PDB entry)

8. Domain d1meyc_: 1mey C: [46430]

Details for d1meyc_

PDB Entry: 1mey, 2.2 Å

PDB Description: crystal structure of a designed zinc finger protein bound to dna

SCOP Domain Sequences for d1meyc_:

Sequence; same for both SEQRES and ATOM records:

>d1meyc_ k.12.1.1 (C:) Designed zinc finger protein {Synthetic consensus sequence, non-biological source}
ekpykcpecgksfsqssnlqkhqrthtgekpykcpecgksfsqssdlqkhqrthtgekpy
kcpecgksfsrsdhlsrhqrthq

Timeline for d1meyc_:

• d1meyc_ first appeared (with stable ids) in SCOP 1.55
  
• d1meyc_ appears in SCOP 1.69
  
• d1meyc_ appears in SCOP 1.73
  
• d1meyc_ appears in the current release, SCOPe 2.08