Lineage for d1ec5c_ (1ec5 C:)

  1. Root: SCOP 1.55
  2. Class k: Designed proteins [58788] (24 folds)
  3. Fold k.8: Designed four helix bundle protein [58832] (1 superfamily)
  4. Superfamily k.8.1: Designed four helix bundle protein [58833] (1 family) (S)
  5. Family k.8.1.1: Designed four helix bundle protein [58834] (2 proteins)
  6. Protein Artificial diiron protein [58837] (1 species)
  7. Species Synthetic [58838] (2 PDB entries)
  8. Domain d1ec5c_: 1ec5 C: [46423]

Details for d1ec5c_

PDB Entry: 1ec5 (more details), 2.5 Å

PDB Description: crystal structure of four-helix bundle model

SCOP Domain Sequences for d1ec5c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ec5c_ k.8.1.1 (C:) Artificial diiron protein {Synthetic}
dylrellklelqlikqyrealeyvklpvlakiledeekhiewletilg

SCOP Domain Coordinates for d1ec5c_ are not available.

Timeline for d1ec5c_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ec5a_, d1ec5b_