Lineage for d1ec5a_ (1ec5 A:)

  1. Root: SCOPe 2.06
  2. 2273425Class k: Designed proteins [58788] (44 folds)
  3. 2273561Fold k.8: Designed four-helix bundle protein [58832] (1 superfamily)
  4. 2273562Superfamily k.8.1: Designed four-helix bundle protein [58833] (1 family) (S)
  5. 2273563Family k.8.1.1: Designed four-helix bundle protein [58834] (4 proteins)
    this is not a true family
  6. 2273564Protein Artificial diiron protein [58837] (1 species)
    dimeric alpha-hairpin fold
  7. 2273565Species Synthetic, different variants [58838] (12 PDB entries)
  8. 2273585Domain d1ec5a_: 1ec5 A: [46421]
    complexed with zn

Details for d1ec5a_

PDB Entry: 1ec5 (more details), 2.5 Å

PDB Description: crystal structure of four-helix bundle model
PDB Compounds: (A:) protein (four-helix bundle model)

SCOPe Domain Sequences for d1ec5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ec5a_ k.8.1.1 (A:) Artificial diiron protein {Synthetic, different variants}
dylrellklelqlikqyrealeyvklpvlakiledeekhiewletilg

SCOPe Domain Coordinates for d1ec5a_:

Click to download the PDB-style file with coordinates for d1ec5a_.
(The format of our PDB-style files is described here.)

Timeline for d1ec5a_: