Lineage for d1cisa_ (1cis A:)

  1. Root: SCOPe 2.08
  2. Class k: Designed proteins [58788] (44 folds)
  3. Fold k.1: Hybrid and chimeric proteins [58789] (1 superfamily)
  4. Superfamily k.1.1: Hybrid and chimeric proteins [58790] (1 family) (S)
  5. Family k.1.1.1: Hybrid and chimeric proteins [58791] (3 proteins)
  6. Protein Hybrid protein between chymotrypsin inhibitor CI-2 and helix E from subtilisin Carlsberg [58792] (1 species)
  7. Species Barley (Hordeum vulgare), hiproly strain [TaxId:4513] [58793] (1 PDB entry)
  8. Domain d1cisa_: 1cis A: [46375]

Details for d1cisa_

PDB Entry: 1cis (more details)

PDB Description: context dependence of protein secondary structure formation. the three-dimensional structure and stability of a hybrid between chymotrypsin inhibitor 2 and helix e from subtilisin carlsberg
PDB Compounds: (A:) hybrid protein formed from chymotrypsin inhibitor-2

SCOPe Domain Sequences for d1cisa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cisa_ k.1.1.1 (A:) Hybrid protein between chymotrypsin inhibitor CI-2 and helix E from subtilisin Carlsberg {Barley (Hordeum vulgare), hiproly strain [TaxId: 4513]}
mktewpelvgksveeakkvilqdkpeaqiivlekqavdnayaeyridrvrlavdkldnia
qvprvg

SCOPe Domain Coordinates for d1cisa_ are not available.

Timeline for d1cisa_: