Lineage for d1ho0a_ (1ho0 A:)

  1. Root: SCOPe 2.07
  2. 2650239Class j: Peptides [58231] (148 folds)
  3. 2651597Fold j.75: Isolated insulin B-chain [58773] (1 superfamily)
  4. 2651598Superfamily j.75.1: Isolated insulin B-chain [58774] (1 family) (S)
  5. 2651599Family j.75.1.1: Isolated insulin B-chain [58775] (1 protein)
  6. 2651600Protein Isolated insulin B-chain [58776] (3 species)
  7. 2651659Species Synthetic, based on Bos taurus sequence [58777] (1 PDB entry)
  8. 2651660Domain d1ho0a_: 1ho0 A: [46372]
    mutant

Details for d1ho0a_

PDB Entry: 1ho0 (more details)

PDB Description: new b-chain mutant of bovine insulin
PDB Compounds: (A:) insulin

SCOPe Domain Sequences for d1ho0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ho0a_ j.75.1.1 (A:) Isolated insulin B-chain {Synthetic, based on Bos taurus sequence}
fvnqhlsgshlvealylvsgergffytpka

SCOPe Domain Coordinates for d1ho0a_:

Click to download the PDB-style file with coordinates for d1ho0a_.
(The format of our PDB-style files is described here.)

Timeline for d1ho0a_: