SCOPe 2.06: Domain d1ho0a_: 1ho0 A:

Lineage for d1ho0a_ (1ho0 A:)

1. Root: SCOPe 2.06

2. Class j: Peptides [58231] (133 folds)

3. Fold j.75: Isolated insulin B-chain [58773] (1 superfamily)

4. Superfamily j.75.1: Isolated insulin B-chain [58774] (1 family)

5. Family j.75.1.1: Isolated insulin B-chain [58775] (1 protein)

6. Protein Isolated insulin B-chain [58776] (3 species)

7. Species Synthetic, based on Bos taurus sequence [58777] (1 PDB entry)

8. Domain d1ho0a_: 1ho0 A: [46372]
   mutant

Details for d1ho0a_

PDB Entry: 1ho0

PDB Description: new b-chain mutant of bovine insulin

PDB Compounds: (A:) insulin

SCOPe Domain Sequences for d1ho0a_:

Sequence; same for both SEQRES and ATOM records:

>d1ho0a_ j.75.1.1 (A:) Isolated insulin B-chain {Synthetic, based on Bos taurus sequence}
fvnqhlsgshlvealylvsgergffytpka

Timeline for d1ho0a_:

• d1ho0a_ first appeared (with stable ids) in SCOP 1.55
  
• d1ho0a_ appears in SCOPe 2.05
  
• d1ho0a_ appears in SCOPe 2.07
  
• d1ho0a_ appears in the current release, SCOPe 2.08