Lineage for d1ho0a_ (1ho0 A:)

  1. Root: SCOP 1.55
  2. Class j: Peptides [58231] (77 folds)
  3. Fold j.75: Isolated insulin B-chain [58773] (1 superfamily)
  4. Superfamily j.75.1: Isolated insulin B-chain [58774] (1 family) (S)
  5. Family j.75.1.1: Isolated insulin B-chain [58775] (1 protein)
  6. Protein Isolated insulin B-chain [58776] (1 species)
  7. Species Synthetic, based on Bos taurus sequence [58777] (1 PDB entry)
  8. Domain d1ho0a_: 1ho0 A: [46372]

Details for d1ho0a_

PDB Entry: 1ho0 (more details)

PDB Description: new b-chain mutant of bovine insulin

SCOP Domain Sequences for d1ho0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ho0a_ j.75.1.1 (A:) Isolated insulin B-chain {Synthetic, based on Bos taurus sequence}
fvnqhlsgshlvealylvsgergffytpka

SCOP Domain Coordinates for d1ho0a_ are not available.

Timeline for d1ho0a_: