Lineage for d1g3jb_ (1g3j B:)

  1. Root: SCOP 1.73
  2. 756025Class j: Peptides [58231] (120 folds)
  3. 757281Fold j.71: beta-Catenine bound non-globular protein regions [58753] (1 superfamily)
  4. 757282Superfamily j.71.1: beta-Catenine bound non-globular protein regions [58754] (1 family) (S)
  5. 757283Family j.71.1.1: beta-Catenine bound non-globular protein regions [58755] (3 proteins)
  6. 757296Protein TCF3-CBD (catenin-binding domain) [58756] (1 species)
  7. 757297Species Frog (Xenopus) [TaxId:262014] [58757] (1 PDB entry)
  8. 757298Domain d1g3jb_: 1g3j B: [46366]
    Other proteins in same PDB: d1g3ja_, d1g3jc_

Details for d1g3jb_

PDB Entry: 1g3j (more details), 2.1 Å

PDB Description: crystal structure of the xtcf3-cbd/beta-catenin armadillo repeat complex
PDB Compounds: (B:) tcf3-cbd (catenin binding domain)

SCOP Domain Sequences for d1g3jb_:

Sequence, based on SEQRES records: (download)

>d1g3jb_ j.71.1.1 (B:) TCF3-CBD (catenin-binding domain) {Frog (Xenopus) [TaxId: 262014]}
pqlnsgggdelgandelirfkdegeqeekspgegsaegdladvksslvnes

Sequence, based on observed residues (ATOM records): (download)

>d1g3jb_ j.71.1.1 (B:) TCF3-CBD (catenin-binding domain) {Frog (Xenopus) [TaxId: 262014]}
pqlnsgggdelgandelirfkdegeqeedladvksslvnes

SCOP Domain Coordinates for d1g3jb_:

Click to download the PDB-style file with coordinates for d1g3jb_.
(The format of our PDB-style files is described here.)

Timeline for d1g3jb_: