Lineage for d1f02t1 (1f02 T:272-336)

  1. Root: SCOPe 2.06
  2. 2271421Class j: Peptides [58231] (133 folds)
  3. 2272707Fold j.67: Translocated intimin receptor (tir) intimin-binding domain [58733] (1 superfamily)
  4. 2272708Superfamily j.67.1: Translocated intimin receptor (tir) intimin-binding domain [58734] (1 family) (S)
  5. 2272709Family j.67.1.1: Translocated intimin receptor (tir) intimin-binding domain [58735] (1 protein)
  6. 2272710Protein Translocated intimin receptor (tir) intimin-binding domain [58736] (1 species)
  7. 2272711Species Escherichia coli [TaxId:562] [58737] (1 PDB entry)
  8. 2272712Domain d1f02t1: 1f02 T:272-336 [46360]
    Other proteins in same PDB: d1f02i1, d1f02i2, d1f02i3, d1f02t2

Details for d1f02t1

PDB Entry: 1f02 (more details), 2.9 Å

PDB Description: crystal structure of c-terminal 282-residue fragment of intimin in complex with translocated intimin receptor (tir) intimin-binding domain
PDB Compounds: (T:) translocated intimin receptor

SCOPe Domain Sequences for d1f02t1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f02t1 j.67.1.1 (T:272-336) Translocated intimin receptor (tir) intimin-binding domain {Escherichia coli [TaxId: 562]}
dqaanaaesatkdqltqeafknpenqkvnidangnaipsgelkddiveqiaqqakeagev
arqqa

SCOPe Domain Coordinates for d1f02t1:

Click to download the PDB-style file with coordinates for d1f02t1.
(The format of our PDB-style files is described here.)

Timeline for d1f02t1: