Lineage for d1f3mb_ (1f3m B:)

  1. Root: SCOPe 2.07
  2. 2650239Class j: Peptides [58231] (148 folds)
  3. 2651520Fold j.66: pak1 autoregulatory domain [58728] (1 superfamily)
  4. 2651521Superfamily j.66.1: pak1 autoregulatory domain [58729] (1 family) (S)
  5. 2651522Family j.66.1.1: pak1 autoregulatory domain [58730] (1 protein)
  6. 2651523Protein pak1 autoregulatory domain [58731] (1 species)
  7. 2651524Species Human (Homo sapiens) [TaxId:9606] [58732] (1 PDB entry)
  8. 2651526Domain d1f3mb_: 1f3m B: [46359]
    Other proteins in same PDB: d1f3mc_, d1f3md_
    complexed with iod

Details for d1f3mb_

PDB Entry: 1f3m (more details), 2.3 Å

PDB Description: crystal structure of human serine/threonine kinase pak1
PDB Compounds: (B:) serine/threonine-protein kinase pak-alpha

SCOPe Domain Sequences for d1f3mb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f3mb_ j.66.1.1 (B:) pak1 autoregulatory domain {Human (Homo sapiens) [TaxId: 9606]}
psdfehtihvgfdavtgeftgmpeqwarllqtsnitkseqkknpqavldvlefynskkts
nsqkymsftd

SCOPe Domain Coordinates for d1f3mb_:

Click to download the PDB-style file with coordinates for d1f3mb_.
(The format of our PDB-style files is described here.)

Timeline for d1f3mb_: