Lineage for d1f3mb_ (1f3m B:)

  1. Root: SCOP 1.55
  2. Class j: Peptides [58231] (77 folds)
  3. Fold j.66: pak1 autoregulatory domain [58728] (1 superfamily)
  4. Superfamily j.66.1: pak1 autoregulatory domain [58729] (1 family) (S)
  5. Family j.66.1.1: pak1 autoregulatory domain [58730] (1 protein)
  6. Protein pak1 autoregulatory domain [58731] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [58732] (1 PDB entry)
  8. Domain d1f3mb_: 1f3m B: [46359]
    Other proteins in same PDB: d1f3mc_, d1f3md_

Details for d1f3mb_

PDB Entry: 1f3m (more details), 2.3 Å

PDB Description: crystal structure of human serine/threonine kinase pak1

SCOP Domain Sequences for d1f3mb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f3mb_ j.66.1.1 (B:) pak1 autoregulatory domain {Human (Homo sapiens)}
psdfehtihvgfdavtgeftgmpeqwarllqtsnitkseqkknpqavldvlefynskkts
nsqkymsftd

SCOP Domain Coordinates for d1f3mb_ are not available.

Timeline for d1f3mb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1f3ma_, d1f3mc_, d1f3md_