Lineage for d1e0ab1 (1e0a B:75-118)

  1. Root: SCOPe 2.06
  2. 2271421Class j: Peptides [58231] (133 folds)
  3. 2272692Fold j.65: Peptide derived from p-21 activated kinase [58722] (1 superfamily)
  4. 2272693Superfamily j.65.1: Peptide derived from p-21 activated kinase [58723] (1 family) (S)
  5. 2272694Family j.65.1.1: Peptide derived from p-21 activated kinase [58724] (1 protein)
  6. 2272695Protein Peptide derived from p-21 activated kinase [58725] (2 species)
  7. 2272698Species Norway rat (Rattus norvegicus) [TaxId:10116] [58727] (1 PDB entry)
  8. 2272699Domain d1e0ab1: 1e0a B:75-118 [46357]
    Other proteins in same PDB: d1e0aa_, d1e0ab2
    bound to CDC42Hs
    complexed with gnp, mg

Details for d1e0ab1

PDB Entry: 1e0a (more details)

PDB Description: cdc42 complexed with the gtpase binding domain of p21 activated kinase
PDB Compounds: (B:) serine/threonine-protein kinase pak-alpha

SCOPe Domain Sequences for d1e0ab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e0ab1 j.65.1.1 (B:75-118) Peptide derived from p-21 activated kinase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
islpsdfehtihvgfdavtgeftgmpeqwarllqtsnitkseqk

SCOPe Domain Coordinates for d1e0ab1:

Click to download the PDB-style file with coordinates for d1e0ab1.
(The format of our PDB-style files is described here.)

Timeline for d1e0ab1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e0ab2
View in 3D
Domains from other chains:
(mouse over for more information)
d1e0aa_