Lineage for d1eesb_ (1ees B:)

  1. Root: SCOPe 2.01
  2. 1072259Class j: Peptides [58231] (120 folds)
  3. 1073526Fold j.65: Peptide derived from p-21 activated kinase [58722] (1 superfamily)
  4. 1073527Superfamily j.65.1: Peptide derived from p-21 activated kinase [58723] (1 family) (S)
  5. 1073528Family j.65.1.1: Peptide derived from p-21 activated kinase [58724] (1 protein)
  6. 1073529Protein Peptide derived from p-21 activated kinase [58725] (2 species)
  7. 1073530Species Mouse (Mus musculus) [TaxId:10090] [58726] (1 PDB entry)
  8. 1073531Domain d1eesb_: 1ees B: [46356]
    Other proteins in same PDB: d1eesa_
    bound to CDC42Hs

Details for d1eesb_

PDB Entry: 1ees (more details)

PDB Description: solution structure of cdc42hs complexed with a peptide derived from p-21 activated kinase, nmr, 20 structures
PDB Compounds: (B:) p21-activated kinase

SCOPe Domain Sequences for d1eesb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eesb_ j.65.1.1 (B:) Peptide derived from p-21 activated kinase {Mouse (Mus musculus) [TaxId: 10090]}
gskerpeislpsdfehtihvgfdavtgeftgipeqwarllqtsnit

SCOPe Domain Coordinates for d1eesb_:

Click to download the PDB-style file with coordinates for d1eesb_.
(The format of our PDB-style files is described here.)

Timeline for d1eesb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1eesa_