Lineage for d1cwxa_ (1cwx A:)

  1. Root: SCOP 1.55
  2. Class j: Peptides [58231] (77 folds)
  3. Fold j.54: Hepatitis C virus N-terminal capsid protein fragment 2-45 [58667] (1 superfamily)
  4. Superfamily j.54.1: Hepatitis C virus N-terminal capsid protein fragment 2-45 [58668] (1 family) (S)
  5. Family j.54.1.1: Hepatitis C virus N-terminal capsid protein fragment 2-45 [58669] (1 protein)
  6. Protein Hepatitis C virus N-terminal capsid protein fragment 2-45 [58670] (1 species)
  7. Species Synthetic [58671] (1 PDB entry)
  8. Domain d1cwxa_: 1cwx A: [46338]

Details for d1cwxa_

PDB Entry: 1cwx (more details)

PDB Description: solution structure of the hepatitis c virus n-terminal capsid protein 2-45 [c-hcv(2-45)]

SCOP Domain Sequences for d1cwxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cwxa_ j.54.1.1 (A:) Hepatitis C virus N-terminal capsid protein fragment 2-45 {Synthetic}
stnpkpqrktkrntnrrpqdvkfpgggqivggvyllprrgprlg

SCOP Domain Coordinates for d1cwxa_ are not available.

Timeline for d1cwxa_: