Class j: Peptides [58231] (148 folds) |
Fold j.51: cAMP and cGMP phosphodiesterase (PDE) fragments [58650] (1 superfamily) |
Superfamily j.51.1: cAMP and cGMP phosphodiesterase (PDE) fragments [58651] (1 family) |
Family j.51.1.1: cAMP and cGMP phosphodiesterase (PDE) fragments [58652] (2 proteins) not a true family |
Protein cGMP-PDE gamma [58655] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [58656] (1 PDB entry) |
Domain d1fqjc_: 1fqj C: [46332] Other proteins in same PDB: d1fqja1, d1fqja2, d1fqjb_, d1fqjd1, d1fqjd2, d1fqje_ residues 46-87 bound to Gi1 alpha complexed with alf, gdp, mg |
PDB Entry: 1fqj (more details), 2.02 Å
SCOPe Domain Sequences for d1fqjc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fqjc_ j.51.1.1 (C:) cGMP-PDE gamma {Cow (Bos taurus) [TaxId: 9913]} fgddipgmeglgtditvicpweafnhlelhelaqygii
Timeline for d1fqjc_: