Lineage for d1fqjc_ (1fqj C:)

  1. Root: SCOPe 2.05
  2. 1973804Class j: Peptides [58231] (129 folds)
  3. 1974952Fold j.51: cAMP and cGMP phosphodiesterase (PDE) fragments [58650] (1 superfamily)
  4. 1974953Superfamily j.51.1: cAMP and cGMP phosphodiesterase (PDE) fragments [58651] (1 family) (S)
  5. 1974954Family j.51.1.1: cAMP and cGMP phosphodiesterase (PDE) fragments [58652] (2 proteins)
    not a true family
  6. 1974955Protein cGMP-PDE gamma [58655] (1 species)
  7. 1974956Species Cow (Bos taurus) [TaxId:9913] [58656] (1 PDB entry)
  8. 1974957Domain d1fqjc_: 1fqj C: [46332]
    Other proteins in same PDB: d1fqja1, d1fqja2, d1fqjb_, d1fqjd1, d1fqjd2, d1fqje_
    residues 46-87 bound to Gi1 alpha
    complexed with alf, gdp, mg

Details for d1fqjc_

PDB Entry: 1fqj (more details), 2.02 Å

PDB Description: crystal structure of the heterotrimeric complex of the rgs domain of rgs9, the gamma subunit of phosphodiesterase and the gt/i1 chimera alpha subunit [(rgs9)-(pdegamma)-(gt/i1alpha)-(gdp)-(alf4-)-(mg2+)]
PDB Compounds: (C:) retinal rod rhodopsin-sensitive cgmp 3',5'-cyclic phosphodiesterase gamma-subunit

SCOPe Domain Sequences for d1fqjc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fqjc_ j.51.1.1 (C:) cGMP-PDE gamma {Cow (Bos taurus) [TaxId: 9913]}
fgddipgmeglgtditvicpweafnhlelhelaqygii

SCOPe Domain Coordinates for d1fqjc_:

Click to download the PDB-style file with coordinates for d1fqjc_.
(The format of our PDB-style files is described here.)

Timeline for d1fqjc_: