Lineage for d1ba6__ (1ba6 -)

  1. Root: SCOP 1.55
  2. Class j: Peptides [58231] (77 folds)
  3. Fold j.42: Amyloid peptides [58604] (1 superfamily)
  4. Superfamily j.42.1: Amyloid peptides [58605] (1 family) (S)
  5. Family j.42.1.1: Amyloid peptides [58606] (1 protein)
  6. Protein Alzheimer's disease amyloid beta-peptide [58607] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [58608] (9 PDB entries)
  8. Domain d1ba6__: 1ba6 - [46315]

Details for d1ba6__

PDB Entry: 1ba6 (more details)

PDB Description: solution structure of the methionine-oxidized amyloid beta-peptide (1-40). does oxidation affect conformational switching? nmr, 10 structures

SCOP Domain Sequences for d1ba6__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ba6__ j.42.1.1 (-) Alzheimer's disease amyloid beta-peptide {Human (Homo sapiens)}
daefrhdsgyevhhqklvffaedvgsnkgaiiglmvggvv

SCOP Domain Coordinates for d1ba6__ are not available.

Timeline for d1ba6__: