Lineage for d1ba6a_ (1ba6 A:)

  1. Root: SCOPe 2.07
  2. 2596047Class j: Peptides [58231] (148 folds)
  3. 2597112Fold j.42: Amyloid peptides [58604] (1 superfamily)
  4. 2597113Superfamily j.42.1: Amyloid peptides [58605] (1 family) (S)
  5. 2597114Family j.42.1.1: Amyloid peptides [58606] (4 proteins)
  6. 2597115Protein Alzheimer's disease amyloid beta-peptide [58607] (2 species)
  7. 2597116Species Human (Homo sapiens) [TaxId:9606] [58608] (14 PDB entries)
    Uniprot P05067 696-706 # coverage from PDB
  8. 2597125Domain d1ba6a_: 1ba6 A: [46315]
    residues 1-40

Details for d1ba6a_

PDB Entry: 1ba6 (more details)

PDB Description: solution structure of the methionine-oxidized amyloid beta-peptide (1-40). does oxidation affect conformational switching? nmr, 10 structures
PDB Compounds: (A:) amyloid beta-peptide

SCOPe Domain Sequences for d1ba6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ba6a_ j.42.1.1 (A:) Alzheimer's disease amyloid beta-peptide {Human (Homo sapiens) [TaxId: 9606]}
daefrhdsgyevhhqklvffaedvgsnkgaiiglmvggvv

SCOPe Domain Coordinates for d1ba6a_:

Click to download the PDB-style file with coordinates for d1ba6a_.
(The format of our PDB-style files is described here.)

Timeline for d1ba6a_: