Lineage for d1aml__ (1aml -)

  1. Root: SCOP 1.55
  2. Class j: Peptides [58231] (77 folds)
  3. Fold j.42: Amyloid peptides [58604] (1 superfamily)
  4. Superfamily j.42.1: Amyloid peptides [58605] (1 family) (S)
  5. Family j.42.1.1: Amyloid peptides [58606] (1 protein)
  6. Protein Alzheimer's disease amyloid beta-peptide [58607] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [58608] (9 PDB entries)
  8. Domain d1aml__: 1aml - [46314]

Details for d1aml__

PDB Entry: 1aml (more details)

PDB Description: the alzheimer`s disease amyloid a4 peptide (residues 1-40)

SCOP Domain Sequences for d1aml__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aml__ j.42.1.1 (-) Alzheimer's disease amyloid beta-peptide {Human (Homo sapiens)}
daefrhdsgyevhhqklvffaedvgsnkgaiiglmvggvv

SCOP Domain Coordinates for d1aml__ are not available.

Timeline for d1aml__: