Lineage for d1amla_ (1aml A:)

  1. Root: SCOPe 2.08
  2. 3045664Class j: Peptides [58231] (151 folds)
  3. 3046731Fold j.42: Amyloid peptides [58604] (1 superfamily)
  4. 3046732Superfamily j.42.1: Amyloid peptides [58605] (1 family) (S)
  5. 3046733Family j.42.1.1: Amyloid peptides [58606] (4 proteins)
  6. 3046734Protein Alzheimer's disease amyloid beta-peptide [58607] (2 species)
  7. 3046735Species Human (Homo sapiens) [TaxId:9606] [58608] (14 PDB entries)
    Uniprot P05067 696-706 # coverage from PDB
  8. 3046743Domain d1amla_: 1aml A: [46314]
    residues 1-40

Details for d1amla_

PDB Entry: 1aml (more details)

PDB Description: the alzheimer`s disease amyloid a4 peptide (residues 1-40)
PDB Compounds: (A:) amyloid a4

SCOPe Domain Sequences for d1amla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1amla_ j.42.1.1 (A:) Alzheimer's disease amyloid beta-peptide {Human (Homo sapiens) [TaxId: 9606]}
daefrhdsgyevhhqklvffaedvgsnkgaiiglmvggvv

SCOPe Domain Coordinates for d1amla_:

Click to download the PDB-style file with coordinates for d1amla_.
(The format of our PDB-style files is described here.)

Timeline for d1amla_: