SCOP 1.57: Domain d1ba4__: 1ba4 -

Lineage for d1ba4__ (1ba4 -)

1. Root: SCOP 1.57
2. Class j: Peptides [58231] (84 folds)
3. Fold j.42: Amyloid peptides [58604] (1 superfamily)
4. Superfamily j.42.1: Amyloid peptides [58605] (1 family)
5. Family j.42.1.1: Amyloid peptides [58606] (1 protein)
6. Protein Alzheimer's disease amyloid beta-peptide [58607] (1 species)
7. Species Human (Homo sapiens) [TaxId:9606] [58608] (9 PDB entries)
8. Domain d1ba4__: 1ba4 - [46312]

Details for d1ba4__

PDB Entry: 1ba4

PDB Description: the solution structure of amyloid beta-peptide (1-40) in a water- micelle environment. is the membrane-spanning domain where we think it is? nmr, 10 structures

SCOP Domain Sequences for d1ba4__:

Sequence; same for both SEQRES and ATOM records:

>d1ba4__ j.42.1.1 (-) Alzheimer's disease amyloid beta-peptide {Human (Homo sapiens)}
daefrhdsgyevhhqklvffaedvgsnkgaiiglmvggvv

SCOP Domain Coordinates for d1ba4__ are not available.

Timeline for d1ba4__:

• d1ba4__ first appeared (with stable ids) in SCOP 1.55
  
• d1ba4__ appears in SCOP 1.59
  
• d1ba4__ appears in the current release, SCOPe 2.08, called d1ba4a_