SCOPe 2.08: Domain d1ba4a_: 1ba4 A:

Lineage for d1ba4a_ (1ba4 A:)

1. Root: SCOPe 2.08

2. Class j: Peptides [58231] (151 folds)

3. Fold j.42: Amyloid peptides [58604] (1 superfamily)

4. Superfamily j.42.1: Amyloid peptides [58605] (1 family)

5. Family j.42.1.1: Amyloid peptides [58606] (4 proteins)

6. Protein Alzheimer's disease amyloid beta-peptide [58607] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [58608] (14 PDB entries)
   Uniprot P05067 696-706 # coverage from PDB

8. Domain d1ba4a_: 1ba4 A: [46312]
   residues 1-40

Details for d1ba4a_

PDB Entry: 1ba4

PDB Description: the solution structure of amyloid beta-peptide (1-40) in a water- micelle environment. is the membrane-spanning domain where we think it is? nmr, 10 structures

PDB Compounds: (A:) amyloid beta-peptide

SCOPe Domain Sequences for d1ba4a_:

Sequence; same for both SEQRES and ATOM records:

>d1ba4a_ j.42.1.1 (A:) Alzheimer's disease amyloid beta-peptide {Human (Homo sapiens) [TaxId: 9606]}
daefrhdsgyevhhqklvffaedvgsnkgaiiglmvggvv

Timeline for d1ba4a_:

• d1ba4a_ first appeared (with stable ids) in SCOP 1.55, called d1ba4__
  
• d1ba4a_ appears in SCOPe 2.07