Lineage for d1tvsa_ (1tvs A:)

  1. Root: SCOPe 2.08
  2. Class j: Peptides [58231] (151 folds)
  3. Fold j.40: Transactivation protein TAT [58593] (1 superfamily)
  4. Superfamily j.40.1: Transactivation protein TAT [58594] (1 family) (S)
  5. Family j.40.1.1: Transactivation protein TAT [58595] (1 protein)
  6. Protein Transactivation protein TAT [58596] (2 species)
  7. Species Equine infectious anemia virus, EIAV [TaxId:11665] [58597] (2 PDB entries)
  8. Domain d1tvsa_: 1tvs A: [46303]

Details for d1tvsa_

PDB Entry: 1tvs (more details)

PDB Description: trifluoroethanol stabilizes a helix-turn-helix motif in equine infectious-anemia-virus trans-activator protein
PDB Compounds: (A:) transactivator protein

SCOPe Domain Sequences for d1tvsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tvsa_ j.40.1.1 (A:) Transactivation protein TAT {Equine infectious anemia virus, EIAV [TaxId: 11665]}
ledrripgtaeenlqkssggvpgqntggqearpnyhcqlcflrslgidyldaslrkknkq
rlkaiqqgrqpqyll

SCOPe Domain Coordinates for d1tvsa_ are not available.

Timeline for d1tvsa_: