SCOPe 2.08: Domain d1gw3a_: 1gw3 A:

Lineage for d1gw3a_ (1gw3 A:)

1. Root: SCOPe 2.08

2. Class j: Peptides [58231] (151 folds)

3. Fold j.39: Fragments of apolipoproteins [58579] (1 superfamily)

4. Superfamily j.39.1: Fragments of apolipoproteins [58580] (1 family)

5. Family j.39.1.1: Fragments of apolipoproteins [58581] (1 protein)

6. Protein Fragments of apolipoproteins [58582] (10 species)

7. Species Human (Homo sapiens), synthetic, A-I residues 142-187 [TaxId:9606] [58588] (2 PDB entries)

8. Domain d1gw3a_: 1gw3 A: [46298]

Details for d1gw3a_

PDB Entry: 1gw3

PDB Description: the helix-hinge-helix structural motif in human apolipoprotein a-i determined by nmr spectroscopy, 1 structure

PDB Compounds: (A:) apoa-I

SCOPe Domain Sequences for d1gw3a_:

Sequence; same for both SEQRES and ATOM records:

>d1gw3a_ j.39.1.1 (A:) Fragments of apolipoproteins {Human (Homo sapiens), synthetic, A-I residues 142-187 [TaxId: 9606]}
splgeemrdrarahvdalrthlapysdelrqrlaarlealkengga

Timeline for d1gw3a_:

• d1gw3a_ first appeared (with stable ids) in SCOP 1.55, called d1gw3__
  
• d1gw3a_ appears in SCOPe 2.07