![]() | Class j: Peptides [58231] (151 folds) |
![]() | Fold j.35: Transmembrane helical fragments [58517] (1 superfamily) |
![]() | Superfamily j.35.1: Transmembrane helical fragments [58518] (1 family) ![]() |
![]() | Family j.35.1.1: Transmembrane helical fragments [58519] (30 proteins) the member of this family may be not related |
![]() | Protein Membrane domain of the subunit b of ATP synthase [58536] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [58537] (1 PDB entry) |
![]() | Domain d1b9ua_: 1b9u A: [46260] |
PDB Entry: 1b9u (more details)
SCOPe Domain Sequences for d1b9ua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b9ua_ j.35.1.1 (A:) Membrane domain of the subunit b of ATP synthase {Escherichia coli [TaxId: 562]} mnlnatilgqaiafvlfvlfcmkyvwpplmaaie
Timeline for d1b9ua_: