Lineage for d1b9ua_ (1b9u A:)

  1. Root: SCOPe 2.08
  2. 3045664Class j: Peptides [58231] (151 folds)
  3. 3046491Fold j.35: Transmembrane helical fragments [58517] (1 superfamily)
  4. 3046492Superfamily j.35.1: Transmembrane helical fragments [58518] (1 family) (S)
  5. 3046493Family j.35.1.1: Transmembrane helical fragments [58519] (30 proteins)
    the member of this family may be not related
  6. 3046582Protein Membrane domain of the subunit b of ATP synthase [58536] (1 species)
  7. 3046583Species Escherichia coli [TaxId:562] [58537] (1 PDB entry)
  8. 3046584Domain d1b9ua_: 1b9u A: [46260]

Details for d1b9ua_

PDB Entry: 1b9u (more details)

PDB Description: membrane domain of the subunit b of the e.coli atp synthase
PDB Compounds: (A:) protein (ATP synthase)

SCOPe Domain Sequences for d1b9ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b9ua_ j.35.1.1 (A:) Membrane domain of the subunit b of ATP synthase {Escherichia coli [TaxId: 562]}
mnlnatilgqaiafvlfvlfcmkyvwpplmaaie

SCOPe Domain Coordinates for d1b9ua_:

Click to download the PDB-style file with coordinates for d1b9ua_.
(The format of our PDB-style files is described here.)

Timeline for d1b9ua_: