Lineage for d1afoa_ (1afo A:)

  1. Root: SCOP 1.57
  2. Class j: Peptides [58231] (84 folds)
  3. Fold j.35: Transmembrane helical fragments [58517] (1 superfamily)
  4. Superfamily j.35.1: Transmembrane helical fragments [58518] (1 family) (S)
  5. Family j.35.1.1: Transmembrane helical fragments [58519] (19 proteins)
  6. Protein Dimeric transmembrane domain of glycophorin A [58532] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [58533] (1 PDB entry)
  8. Domain d1afoa_: 1afo A: [46257]

Details for d1afoa_

PDB Entry: 1afo (more details)

PDB Description: dimeric transmembrane domain of human glycophorin a, nmr, 20 structures

SCOP Domain Sequences for d1afoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1afoa_ j.35.1.1 (A:) Dimeric transmembrane domain of glycophorin A {Human (Homo sapiens)}
vqlahhfsepeitliifgvmagvigtillisygirrlikk

SCOP Domain Coordinates for d1afoa_ are not available.

Timeline for d1afoa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1afob_