Class j: Peptides [58231] (148 folds) |
Fold j.35: Transmembrane helical fragments [58517] (1 superfamily) |
Superfamily j.35.1: Transmembrane helical fragments [58518] (1 family) |
Family j.35.1.1: Transmembrane helical fragments [58519] (30 proteins) the member of this family may be not related |
Protein Band 3 [58524] (1 species) |
Species Synthetic peptides based on human band 3 sequence [58525] (9 PDB entries) |
Domain d1bh7a_: 1bh7 A: [46252] |
PDB Entry: 1bh7 (more details)
SCOPe Domain Sequences for d1bh7a_:
Sequence, based on SEQRES records: (download)
>d1bh7a_ j.35.1.1 (A:) Band 3 {Synthetic peptides based on human band 3 sequence} iqlfdrilllfkppkyhpdvpyvkrvktwrmhl
>d1bh7a_ j.35.1.1 (A:) Band 3 {Synthetic peptides based on human band 3 sequence} iqlfdrillfkppkyhpdpyvkrvktwrmhl
Timeline for d1bh7a_: