Lineage for d1bh7a_ (1bh7 A:)

  1. Root: SCOPe 2.07
  2. 2650239Class j: Peptides [58231] (148 folds)
  3. 2651066Fold j.35: Transmembrane helical fragments [58517] (1 superfamily)
  4. 2651067Superfamily j.35.1: Transmembrane helical fragments [58518] (1 family) (S)
  5. 2651068Family j.35.1.1: Transmembrane helical fragments [58519] (30 proteins)
    the member of this family may be not related
  6. 2651086Protein Band 3 [58524] (1 species)
  7. 2651087Species Synthetic peptides based on human band 3 sequence [58525] (9 PDB entries)
  8. 2651093Domain d1bh7a_: 1bh7 A: [46252]

Details for d1bh7a_

PDB Entry: 1bh7 (more details)

PDB Description: a low energy structure for the final cytoplasmic loop of band 3, nmr, minimized average structure
PDB Compounds: (A:) band 3

SCOPe Domain Sequences for d1bh7a_:

Sequence, based on SEQRES records: (download)

>d1bh7a_ j.35.1.1 (A:) Band 3 {Synthetic peptides based on human band 3 sequence}
iqlfdrilllfkppkyhpdvpyvkrvktwrmhl

Sequence, based on observed residues (ATOM records): (download)

>d1bh7a_ j.35.1.1 (A:) Band 3 {Synthetic peptides based on human band 3 sequence}
iqlfdrillfkppkyhpdpyvkrvktwrmhl

SCOPe Domain Coordinates for d1bh7a_:

Click to download the PDB-style file with coordinates for d1bh7a_.
(The format of our PDB-style files is described here.)

Timeline for d1bh7a_: