Lineage for d1bzka_ (1bzk A:)

  1. Root: SCOPe 2.07
  2. 2596047Class j: Peptides [58231] (148 folds)
  3. 2596872Fold j.35: Transmembrane helical fragments [58517] (1 superfamily)
  4. 2596873Superfamily j.35.1: Transmembrane helical fragments [58518] (1 family) (S)
  5. 2596874Family j.35.1.1: Transmembrane helical fragments [58519] (30 proteins)
    the member of this family may be not related
  6. 2596892Protein Band 3 [58524] (1 species)
  7. 2596893Species Synthetic peptides based on human band 3 sequence [58525] (9 PDB entries)
  8. 2596900Domain d1bzka_: 1bzk A: [46250]

Details for d1bzka_

PDB Entry: 1bzk (more details)

PDB Description: structural studies on the effects of the deletion in the red cell anion exchanger (band3, ae1) associated with south east asian ovalocytosis.
PDB Compounds: (A:) protein (band 3 anion transport protein)

SCOPe Domain Sequences for d1bzka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bzka_ j.35.1.1 (A:) Band 3 {Synthetic peptides based on human band 3 sequence}
rypyylsditdafspqvlaavifiyfaalspaitfggllgek

SCOPe Domain Coordinates for d1bzka_:

Click to download the PDB-style file with coordinates for d1bzka_.
(The format of our PDB-style files is described here.)

Timeline for d1bzka_: