Lineage for d1edva_ (1edv A:)

  1. Root: SCOPe 2.08
  2. 3045664Class j: Peptides [58231] (151 folds)
  3. 3046491Fold j.35: Transmembrane helical fragments [58517] (1 superfamily)
  4. 3046492Superfamily j.35.1: Transmembrane helical fragments [58518] (1 family) (S)
  5. 3046493Family j.35.1.1: Transmembrane helical fragments [58519] (30 proteins)
    the member of this family may be not related
  6. 3046612Protein Rhodopsin fragments [58522] (1 species)
  7. 3046613Species Synthetic, based on Bos taurus sequence [58523] (6 PDB entries)
  8. 3046616Domain d1edva_: 1edv A: [46242]
    2nd intradiskal loop

Details for d1edva_

PDB Entry: 1edv (more details)

PDB Description: solution structure of 2nd intradiskal loop of bovine rhodopsin (residues 172-205)
PDB Compounds: (A:) rhodopsin

SCOPe Domain Sequences for d1edva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1edva_ j.35.1.1 (A:) Rhodopsin fragments {Synthetic, based on Bos taurus sequence}
lvgwsryipegmqcscgidyytpheetnnesfvi

SCOPe Domain Coordinates for d1edva_:

Click to download the PDB-style file with coordinates for d1edva_.
(The format of our PDB-style files is described here.)

Timeline for d1edva_: