Lineage for d1bhba_ (1bhb A:)

  1. Root: SCOPe 2.07
  2. 2650239Class j: Peptides [58231] (148 folds)
  3. 2651066Fold j.35: Transmembrane helical fragments [58517] (1 superfamily)
  4. 2651067Superfamily j.35.1: Transmembrane helical fragments [58518] (1 family) (S)
  5. 2651068Family j.35.1.1: Transmembrane helical fragments [58519] (30 proteins)
    the member of this family may be not related
  6. 2651081Protein Bacteriorhodopsin fragments [58520] (1 species)
  7. 2651082Species Halobacterium halobium [TaxId:2242] [58521] (3 PDB entries)
  8. 2651084Domain d1bhba_: 1bhb A: [46239]

Details for d1bhba_

PDB Entry: 1bhb (more details)

PDB Description: three-dimensional structure of (1-71) bacterioopsin solubilized in methanol-chloroform and sds micelles determined by 15n-1h heteronuclear nmr spectroscopy
PDB Compounds: (A:) bacteriorhodopsin

SCOPe Domain Sequences for d1bhba_:

Sequence, based on SEQRES records: (download)

>d1bhba_ j.35.1.1 (A:) Bacteriorhodopsin fragments {Halobacterium halobium [TaxId: 2242]}
aqitgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsml
lgygltmvp

Sequence, based on observed residues (ATOM records): (download)

>d1bhba_ j.35.1.1 (A:) Bacteriorhodopsin fragments {Halobacterium halobium [TaxId: 2242]}
aqitgrpewiwlalgtalmglgtlyflvkgmgvpdakkfyaittlvpaiaftmylsmllg
ygltmvp

SCOPe Domain Coordinates for d1bhba_:

Click to download the PDB-style file with coordinates for d1bhba_.
(The format of our PDB-style files is described here.)

Timeline for d1bhba_: