Lineage for d1bhb__ (1bhb -)

  1. Root: SCOP 1.55
  2. Class j: Peptides [58231] (77 folds)
  3. Fold j.35: Transmembrane helical fragments [58517] (1 superfamily)
  4. Superfamily j.35.1: Transmembrane helical fragments [58518] (1 family) (S)
  5. Family j.35.1.1: Transmembrane helical fragments [58519] (17 proteins)
  6. Protein Bacteriorhodopsin fragments [58520] (1 species)
  7. Species Halobacterium halobium [TaxId:2242] [58521] (3 PDB entries)
  8. Domain d1bhb__: 1bhb - [46239]

Details for d1bhb__

PDB Entry: 1bhb (more details)

PDB Description: three-dimensional structure of (1-71) bacterioopsin solubilized in methanol-chloroform and sds micelles determined by 15n-1h heteronuclear nmr spectroscopy

SCOP Domain Sequences for d1bhb__:

Sequence, based on SEQRES records: (download)

>d1bhb__ j.35.1.1 (-) Bacteriorhodopsin fragments {Halobacterium halobium}
aqitgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsml
lgygltmvp

Sequence, based on observed residues (ATOM records): (download)

>d1bhb__ j.35.1.1 (-) Bacteriorhodopsin fragments {Halobacterium halobium}
aqitgrpewiwlalgtalmglgtlyflvkgmgvpdakkfyaittlvpaiaftmylsmllg
ygltmvp

SCOP Domain Coordinates for d1bhb__ are not available.

Timeline for d1bhb__: