SCOPe 2.08: Domain d1bhaa_: 1bha A:

Lineage for d1bhaa_ (1bha A:)

1. Root: SCOPe 2.08

2. Class j: Peptides [58231] (151 folds)

3. Fold j.35: Transmembrane helical fragments [58517] (1 superfamily)

4. Superfamily j.35.1: Transmembrane helical fragments [58518] (1 family)

5. Family j.35.1.1: Transmembrane helical fragments [58519] (30 proteins)
   the member of this family may be not related

6. Protein Bacteriorhodopsin fragments [58520] (1 species)

7. Species Halobacterium halobium [TaxId:2242] [58521] (3 PDB entries)

8. Domain d1bhaa_: 1bha A: [46238]

Details for d1bhaa_

PDB Entry: 1bha

PDB Description: three-dimensional structure of (1-71) bacterioopsin solubilized in methanol-chloroform and sds micelles determined by 15n-1h heteronuclear nmr spectroscopy

PDB Compounds: (A:) bacteriorhodopsin

SCOPe Domain Sequences for d1bhaa_:

Sequence, based on SEQRES records:

>d1bhaa_ j.35.1.1 (A:) Bacteriorhodopsin fragments {Halobacterium halobium [TaxId: 2242]}
aqitgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsml
lgygltmvp

Sequence, based on observed residues (ATOM records):

>d1bhaa_ j.35.1.1 (A:) Bacteriorhodopsin fragments {Halobacterium halobium [TaxId: 2242]}
aqitgrpewiwlalgtalmglgtlyflvkgmgvpdakkfyaittlvpaiaftmylsmllg
ygltmvp

Timeline for d1bhaa_:

• d1bhaa_ first appeared (with stable ids) in SCOP 1.55, called d1bha__
  
• d1bhaa_ appears in SCOPe 2.07