Lineage for d1zwd__ (1zwd -)
- Root: SCOP 1.57
- Class j: Peptides [58231] (84 folds)
- Fold j.15: Parathyroid hormone fragments (residues between 1 and 39) [58378] (1 superfamily)
- Superfamily j.15.1: Parathyroid hormone fragments (residues between 1 and 39) [58379] (1 family)
- Family j.15.1.1: Parathyroid hormone fragments (residues between 1 and 39) [58380] (1 protein)
- Protein Parathyroid hormone fragments (residues between 1 and 39) [58381] (2 species)
- Species Human (Homo sapiens) [TaxId:9606] [58382] (14 PDB entries)
- Domain d1zwd__: 1zwd - [46164]
Details for d1zwd__
PDB Entry: 1zwd (more details)
PDB Description: structure of human parathyroid hormone fragment 3-37, nmr, 10 structures
SCOP Domain Sequences for d1zwd__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zwd__ j.15.1.1 (-) Parathyroid hormone fragments (residues between 1 and 39) {Human (Homo sapiens)}
seiqlmhnlgkhlnsmervewlrkklqdvhnfval
SCOP Domain Coordinates for d1zwd__ are not available.
Timeline for d1zwd__:
- d1zwd__ first appeared (with stable ids) in SCOP 1.55
- d1zwd__ appears in SCOP 1.59
- d1zwd__ appears in the current release, SCOPe 2.08, called d1zwda_