Lineage for d1hpya_ (1hpy A:)

  1. Root: SCOPe 2.08
  2. 3045664Class j: Peptides [58231] (151 folds)
  3. 3046186Fold j.15: Parathyroid hormone fragments (residues between 1 and 39) [58378] (1 superfamily)
  4. 3046187Superfamily j.15.1: Parathyroid hormone fragments (residues between 1 and 39) [58379] (1 family) (S)
  5. 3046188Family j.15.1.1: Parathyroid hormone fragments (residues between 1 and 39) [58380] (1 protein)
  6. 3046189Protein Parathyroid hormone fragments (residues between 1 and 39) [58381] (3 species)
  7. 3046192Species Human (Homo sapiens) [TaxId:9606] [58382] (14 PDB entries)
  8. 3046196Domain d1hpya_: 1hpy A: [46161]

Details for d1hpya_

PDB Entry: 1hpy (more details)

PDB Description: the solution structure of human parathyroid hormone fragment 1-34 in 20% trifluorethanol, nmr, 10 structures
PDB Compounds: (A:) parathyroid hormone

SCOPe Domain Sequences for d1hpya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hpya_ j.15.1.1 (A:) Parathyroid hormone fragments (residues between 1 and 39) {Human (Homo sapiens) [TaxId: 9606]}
svseiqlmhnlgkhlnsmervewlrkklqdvhnf

SCOPe Domain Coordinates for d1hpya_:

Click to download the PDB-style file with coordinates for d1hpya_.
(The format of our PDB-style files is described here.)

Timeline for d1hpya_: